STOM (NM_004099) Human Recombinant Protein
CAT#: TP302060
Recombinant protein of human stomatin (STOM), transcript variant 1, 20 µg
View other "STOM" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202060 protein sequence
Red=Cloning site Green=Tags(s) MAEKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGR ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNAD SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAE AEASREARAKVIAAEGEMNASRALKEASMVITEYPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGII GAKHSHLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004090 |
Locus ID | 2040 |
UniProt ID | P27105 |
Refseq Size | 3198 |
Cytogenetics | 9q33.2 |
Refseq ORF | 864 |
Synonyms | BND7; EPB7; EPB72 |
Summary | This gene encodes a member of a highly conserved family of integral membrane proteins. The encoded protein localizes to the cell membrane of red blood cells and other cell types, where it may regulate ion channels and transporters. Loss of localization of the encoded protein is associated with hereditary stomatocytosis, a form of hemolytic anemia. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418214 | STOM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418214 | Transient overexpression lysate of stomatin (STOM), transcript variant 1 |
CNY 3,080.00 |
|
PH302060 | STOM MS Standard C13 and N15-labeled recombinant protein (NP_004090) |
CNY 19,520.00 |