UBE2V1 (NM_001032288) Human Recombinant Protein
CAT#: TP301824
Recombinant protein of human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 4, 20 µg
View other "UBE2V1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201824 protein sequence
Red=Cloning site Green=Tags(s) MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE CGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPP EGQCYSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001027459 |
Locus ID | 7335 |
UniProt ID | Q13404 |
Refseq Size | 2158 |
Cytogenetics | 20q13.13 |
Refseq ORF | 441 |
Synonyms | CIR1; CROC-1; CROC1; UBE2V; UEV-1; UEV1; UEV1A |
Summary | Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422298 | UBE2V1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY422298 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 4 |
CN¥ 3,080.00 |
|
PH301824 | UBE2V1 MS Standard C13 and N15-labeled recombinant protein (NP_001027459) |
CN¥ 19,520.00 |