UBE2V1 (NM_001032288) Human Mass Spec Standard
CAT#: PH301824
UBE2V1 MS Standard C13 and N15-labeled recombinant protein (NP_001027459)
View other "UBE2V1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UBE2V1 MS Standard C13 and N15-labeled recombinant protein (NP_001027459) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201824 |
Predicted MW | 16.5 kDa |
Protein Sequence |
>RC201824 protein sequence
Red=Cloning site Green=Tags(s) MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIE CGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPP EGQCYSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001027459 |
RefSeq Size | 2158 |
RefSeq ORF | 441 |
Synonyms | CIR1; CROC-1; CROC1; UBE2V; UEV-1; UEV1; UEV1A |
Locus ID | 7335 |
Cytogenetics | 20q13.13 |
Summary | Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Apr 2012] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422298 | UBE2V1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422298 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 4 |
CNY 3,080.00 |
|
TP301824 | Recombinant protein of human ubiquitin-conjugating enzyme E2 variant 1 (UBE2V1), transcript variant 4, 20 µg |
CNY 2,900.00 |