FUS (NM_004960) Human Recombinant Protein
CAT#: TP301808
Recombinant protein of human fusion (involved in t(12;16) in malignant liposarcoma) (FUS), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 5 publications. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201808 protein sequence
Red=Cloning site Green=Tags(s) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.2 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Transmission electron microscopy (PMID: 26286827) Co-immunoprecipitation (PMID: 27164932) In vitro kinase assay inhibitor (PMID: 29513652) |
Reference Data | |
RefSeq | NP_004951 |
Locus ID | 2521 |
UniProt ID | P35637, Q6IBQ5 |
Refseq Size | 5119 |
Cytogenetics | 16p11.2 |
Refseq ORF | 1578 |
Synonyms | ALS6; altFUS; ETM4; FUS1; HNRNPP2; POMP75; TLS |
Summary | This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Citations (5)
The use of this Proteins has been cited in the following citations: |
---|
Molecular Dissection of FUS Points at Synergistic Effect of Low-Complexity Domains in Toxicity
,Bogaert, E;Boeynaems, S;Kato, M;Guo, L;Caulfield, TR;Steyaert, J;Scheveneels, W;Wilmans, N;Haeck, W;Hersmus, N;Schymkowitz, J;Rousseau, F;Shorter, J;Callaerts, P;Robberecht, W;Van Damme, P;Van Den Bosch, L;,
Cell Rep
,PubMed ID 30021151
[FUS]
|
EWS-FLI1 increases transcription to cause R-loops and block BRCA1 repair in Ewing sarcoma
,Gorthi, A;Romero, JC;Loranc, E;Cao, L;Lawrence, LA;Goodale, E;Iniguez, AB;Bernard, X;Masamsetti, VP;Roston, S;Lawlor, ER;Toretsky, JA;Stegmaier, K;Lessnick, SL;Chen, Y;Bishop, AJR;,
Nature
,PubMed ID 29513652
[FUS]
|
Comparative interactomics analysis of different ALS-associated proteins identifies converging molecular pathways
,Blokhuis, AM;Koppers, M;Groen, EJ;van den Heuvel, DM;Dini Modigliani, S;Anink, JJ;Fumoto, K;van Diggelen, F;Snelting, A;Sodaar, P;Verheijen, BM;Demmers, JA;Veldink, JH;Aronica, E;Bozzoni, I;den Hertog, J;van den Berg, LH;Pasterkamp, RJ;,
Acta Neuropathol.
,PubMed ID 27164932
[FUS]
|
Liquid demixing of intrinsically disordered proteins is seeded by poly(ADP-ribose)
,Altmeyer, M;Neelsen, KJ;Teloni, F;Pozdnyakova, I;Pellegrino, S;Grøfte, M;Rask, MB;Streicher, W;Jungmichel, S;Nielsen, ML;Lukas, J;,
Nat Commun
,PubMed ID 26286827
[FUS]
|
ALS-associated mutations in FUS disrupt the axonal distribution and function of SMN
,Ewout J.N. Groen, Katsumi Fumoto, Anna M. Blokhuis, JooYeon Engelen-Lee, Yeping Zhou, Dianne M.A. van den Heuvel, Max Koppers, Femke van Diggelen, Jessica van Heest, Jeroen A.A. Demmers, Janine Kirby, Pamela J. Shaw, Eleonora Aronica, Wim G.M. Spliet, Jan H. Veldink, Leonard H. van den Berg, and R. Jeroen Pasterkamp,
Hum. Mol. Genet., May 2013; 10.1093/hmg/ddt222.
,PubMed ID 23681068
[FUS]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401541 | FUS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401541 | Transient overexpression lysate of fused in sarcoma (FUS), transcript variant 1 |
CNY 3,080.00 |
|
PH301808 | FUS MS Standard C13 and N15-labeled recombinant protein (NP_004951) |
CNY 19,520.00 |