c-Myc (MYC) (NM_002467) Human Recombinant Protein
CAT#: TP301611
Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), 20 µg
View other "c-Myc" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 8 publications. |
CN¥ 1,999.00
CN¥ 2,700.00
CN¥ 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201611 representing NM_002467
Red=Cloning site Green=Tags(s) LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFEL LPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVV SVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA binding assay (PMID: 25875098) EMSA assay (PMID: 25892221) ELISA capture for autoantibodies (PMID: 28191285) |
Reference Data | |
RefSeq | NP_002458 |
Locus ID | 4609 |
UniProt ID | P01106 |
Refseq Size | 2379 |
Cytogenetics | 8q24.21 |
Refseq ORF | 1362 |
Synonyms | bHLHe39; c-Myc; MRTL; MYCC |
Summary | This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Stem cell relevant signaling - Wnt Signaling pathway, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway, Thyroid cancer, Wnt signaling pathway |
Citations (8)
The use of this Proteins has been cited in the following citations: |
---|
WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
,null,
Nature Communications
,PubMed ID 35768435
[MYC]
|
Discovery of a Functional Covalent Ligand Targeting an Intrinsically Disordered Cysteine within MYC
,Boike, L;Cioffi, AG;Majewski, FC;Co, J;Henning, NJ;Jones, MD;Liu, G;McKenna, JM;Tallarico, JA;Schirle, M;Nomura, DK;,
Cell chemical biology
,PubMed ID 32966806
[MYC]
|
Downregulation of miR-16 via URGCP pathway contributes to glioma growth
,null,
Scientific Reports
,PubMed ID 29044221
[MYC]
|
Autoantibodies against oncogenic ERG protein in prostate cancer: potential use in diagnosis and prognosis in a panel with C-MYC, AMACR and HERV-K Gag
,Rastogi, A;Ali, A;Tan, S;Banerjee, S;Chen, Y;Cullen, J;Xavier, CP;Mohamed, AA;Ravindranath, L;Srivastav, J;Young, D;Sesterhenn, IA;Kagan, J;Srivastava, S;McLeod, DG;Rosner, IL;Petrovics, G;Dobi, A;Srivastava, S;Srinivasan, A;,
Genes & Cancer
,PubMed ID 28191285
[MYC]
|
Pioneer transcription factors target partial DNA motifs on nucleosomes to initiate reprogramming
,Soufi, A;Garcia, MF;Jaroszewicz, A;Osman, N;Pellegrini, M;Zaret, KS;,
Cell
,PubMed ID 25892221
[MYC]
|
Reversible linkage of two distinct small molecule inhibitors of myc generates a dimeric inhibitor with improved potency that is active in myc over-expressing cancer cell lines
,Wanner, J;Romashko, D;Werner, DS;May, EW;Peng, Y;Schulz, R;Foreman, KW;Russo, S;Arnold, LD;Pingle, M;Bergstrom, DE;Barany, F;Thomson, S;,
PLoS ONE
,PubMed ID 25875098
[MYC]
|
Sin3b Interacts with Myc and Decreases Myc Levels
,Garcia-Sanz, P;Quintanilla, A;Lafita, MC;Moreno-Bueno, G;Garcia-Gutierrez, L;Tabor, V;Varela, I;Shiio, Y;Larsson, LG;Portillo, F;Leon, J;,
J. Biol. Chem.
,PubMed ID 24951594
[MYC]
|
Novel IL-21 signaling pathway up-regulates c-Myc and induces apoptosis of diffuse large B-cell lymphomas
,null,
Blood
,PubMed ID 19965678
[MYC]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400876 | MYC HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400876 | Transient overexpression lysate of v-myc myelocytomatosis viral oncogene homolog (avian) (MYC) |
CN¥ 3,080.00 |
|
PH301611 | MYC MS Standard C13 and N15-labeled recombinant protein (NP_002458) |
CN¥ 19,520.00 |
|
TP760019 | Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CN¥ 2,040.00 |
|
TP762403 | Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), Leu1-Asp343, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |
|
TP762404 | Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), His316-END, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |