c-Myc (MYC) (NM_002467) Human Mass Spec Standard
CAT#: PH301611
MYC MS Standard C13 and N15-labeled recombinant protein (NP_002458)
View other "c-Myc" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MYC MS Standard C13 and N15-labeled recombinant protein (NP_002458) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201611 |
Predicted MW | 50.5 kDa |
Protein Sequence |
>RC201611 representing NM_002467
Red=Cloning site Green=Tags(s) LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFEL LPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVV SVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002458 |
RefSeq Size | 2379 |
RefSeq ORF | 1362 |
Synonyms | bHLHe39; c-Myc; MRTL; MYCC |
Locus ID | 4609 |
Cytogenetics | 8q24.21 |
Summary | This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Stem cell relevant signaling - Wnt Signaling pathway, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway, Thyroid cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400876 | MYC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400876 | Transient overexpression lysate of v-myc myelocytomatosis viral oncogene homolog (avian) (MYC) |
CNY 3,080.00 |
|
TP301611 | Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), 20 µg |
CNY 2,900.00 |
|
TP760019 | Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP762403 | Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), Leu1-Asp343, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
|
TP762404 | Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), His316-END, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |