RAB13 (NM_002870) Human Recombinant Protein
CAT#: TP301555
Recombinant protein of human RAB13, member RAS oncogene family (RAB13), 20 µg
View other "RAB13" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201555 protein sequence
Red=Cloning site Green=Tags(s) MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002861 |
Locus ID | 5872 |
UniProt ID | P51153 |
Refseq Size | 1235 |
Cytogenetics | 1q21.3 |
Refseq ORF | 609 |
Synonyms | GIG4 |
Summary | This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401011 | RAB13 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401011 | Transient overexpression lysate of RAB13, member RAS oncogene family (RAB13) |
CN¥ 3,080.00 |
|
PH301555 | RAB13 MS Standard C13 and N15-labeled recombinant protein (NP_002861) |
CN¥ 19,520.00 |