RAB13 (NM_002870) Human Mass Spec Standard
CAT#: PH301555
RAB13 MS Standard C13 and N15-labeled recombinant protein (NP_002861)
View other "RAB13" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB13 MS Standard C13 and N15-labeled recombinant protein (NP_002861) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201555 |
Predicted MW | 22.8 kDa |
Protein Sequence |
>RC201555 protein sequence
Red=Cloning site Green=Tags(s) MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERF KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLA REHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002861 |
RefSeq Size | 1235 |
RefSeq ORF | 609 |
Synonyms | GIG4 |
Locus ID | 5872 |
Cytogenetics | 1q21.3 |
Summary | This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401011 | RAB13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401011 | Transient overexpression lysate of RAB13, member RAS oncogene family (RAB13) |
CNY 3,080.00 |
|
TP301555 | Recombinant protein of human RAB13, member RAS oncogene family (RAB13), 20 µg |
CNY 2,900.00 |