DOPA Decarboxylase (DDC) (NM_000790) Human Recombinant Protein
CAT#: TP301345
Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, 20 µg
View other "DOPA Decarboxylase" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201345 protein sequence
Red=Cloning site Green=Tags(s) MNASEFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTH WHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEG GGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIP SDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQ IPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000781 |
Locus ID | 1644 |
UniProt ID | P20711 |
Refseq Size | 1975 |
Cytogenetics | 7p12.2-p12.1 |
Refseq ORF | 1440 |
Synonyms | AADC |
Summary | The encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Histidine metabolism, Metabolic pathways, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400270 | DDC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421202 | DDC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400270 | Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2 |
CNY 3,080.00 |
|
LY421202 | Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1 |
CNY 4,840.00 |
|
PH301345 | DDC MS Standard C13 and N15-labeled recombinant protein (NP_000781) |
CNY 19,520.00 |
|
PH319037 | DDC MS Standard C13 and N15-labeled recombinant protein (NP_001076440) |
CNY 19,520.00 |
|
TP319037 | Recombinant protein of human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它DOPA Decarboxylase产品