EIF1 (NM_005801) Human Recombinant Protein
CAT#: TP301271
Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1), 20 µg
View other "EIF1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201271 protein sequence
Red=Cloning site Green=Tags(s) MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005792 |
Locus ID | 10209 |
UniProt ID | P41567 |
Refseq Size | 1326 |
Cytogenetics | 17q21.2 |
Refseq ORF | 339 |
Synonyms | A121; EIF-1; EIF1A; ISO1; SUI1 |
Summary | Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401762 | EIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401762 | Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) |
CN¥ 3,080.00 |
|
PH301271 | EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792) |
CN¥ 19,520.00 |