EIF1 (NM_005801) Human Mass Spec Standard
CAT#: PH301271
EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792)
View other "EIF1" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201271 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC201271 protein sequence
Red=Cloning site Green=Tags(s) MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005792 |
RefSeq Size | 1326 |
RefSeq ORF | 339 |
Synonyms | A121; EIF-1; EIF1A; ISO1; SUI1 |
Locus ID | 10209 |
Cytogenetics | 17q21.2 |
Summary | Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401762 | EIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401762 | Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) |
CN¥ 3,080.00 |
|
TP301271 | Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1), 20 µg |
CN¥ 2,900.00 |