United States
Germany
Japan
United Kingdom
China
SERBP1 (NM_001018067) Human Recombinant Protein
CAT＃: TP301092
Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1, 20 µg
View other "SERBP1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201092 representing NM_001018067
Red=Cloning site Green=Tags(s) MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGL KHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEV KEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPAND ITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 44.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001018077 |
| Locus ID | 26135 |
| UniProt ID | Q8NC51 |
| Refseq Size | 6764 |
| Cytogenetics | 1p31.3 |
| Refseq ORF | 1224 |
| Synonyms | CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1 |
| Summary | May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Tumor-associated autoantibodies from mouse breast cancer models are found in serum of breast cancer patients
,Stanton, S;Gad, E;Ramos, E;Corulli, L;Annis, J;Childs, J;Katayama, H;Hanash, S;Marks, J;Disis, M;,
npj Breast Cancer
,PubMed ID 33976232
[SERBP1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402455 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422718 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422719 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422720 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402455 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4 |
CNY 3,080.00 |
|
| LY422718 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 |
CNY 3,080.00 |
|
| LY422719 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2 |
CNY 3,080.00 |
|
| LY422720 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 3 |
CNY 3,080.00 |
|
| PH301092 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018077) |
CNY 19,520.00 |
|
| PH303582 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455) |
CNY 19,520.00 |
|
| PH304527 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078) |
CNY 19,520.00 |
|
| TP303582 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP304527 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
