SERBP1 (NM_001018068) Human Mass Spec Standard
CAT#: PH304527
SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078)
View other "SERBP1" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018078) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204527 |
Predicted MW | 44.3 kDa |
Protein Sequence |
>RC204527 protein sequence
Red=Cloning site Green=Tags(s) MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR GGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPK EMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE INFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001018078 |
RefSeq Size | 6746 |
RefSeq ORF | 1206 |
Synonyms | CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1 |
Locus ID | 26135 |
Cytogenetics | 1p31.3 |
Summary | May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. Seems to play a role in PML-nuclear bodies formation (PubMed:28695742).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402455 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422718 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422719 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422720 | SERBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402455 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4 |
CNY 3,080.00 |
|
LY422718 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1 |
CNY 3,080.00 |
|
LY422719 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2 |
CNY 3,080.00 |
|
LY422720 | Transient overexpression lysate of SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 3 |
CNY 3,080.00 |
|
PH301092 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001018077) |
CNY 19,520.00 |
|
PH303582 | SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455) |
CNY 19,520.00 |
|
TP301092 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP303582 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP304527 | Recombinant protein of human SERPINE1 mRNA binding protein 1 (SERBP1), transcript variant 2, 20 µg |
CNY 2,900.00 |