STIP1 (NM_006819) Human Recombinant Protein
CAT#: TP301084
Recombinant protein of human stress-induced-phosphoprotein 1 (STIP1), 20 µg
View other "STIP1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201084 protein sequence
Red=Cloning site Green=Tags(s) MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006810 |
Locus ID | 10963 |
UniProt ID | P31948 |
Refseq Size | 2219 |
Cytogenetics | 11q13.1 |
Refseq ORF | 1629 |
Synonyms | HEL-S-94n; HOP; IEF-SSP-3521; P60; STI1; STI1L |
Summary | STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM, Jul 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Prion diseases |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416401 | STIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416401 | Transient overexpression lysate of stress-induced-phosphoprotein 1 (STIP1) |
CNY 3,080.00 |
|
PH301084 | STIP1 MS Standard C13 and N15-labeled recombinant protein (NP_006810) |
CNY 19,520.00 |
|
TP710087 | Recombinant protein of human human stress-induced-phosphoprotein 1 (STIP1), full length, with N-terminal His tag, expressed in sf9 cells |
CNY 4,020.00 |
|
TP710122 | Recombinant protein of human human stress-induced-phosphoprotein 1 (STIP1), full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4,020.00 |