RBMS1 (NM_002897) Human Recombinant Protein
CAT#: TP301015
Recombinant protein of human RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 3, 20 µg
View other "RBMS1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201015 protein sequence
Red=Cloning site Green=Tags(s) MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLP PHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP TNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPP GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTTAAIQNGFYPSPYSIATNRMI TQTSITPYIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTG TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002888 |
Locus ID | 5937 |
UniProt ID | P29558 |
Refseq Size | 4296 |
Cytogenetics | 2q24.2 |
Refseq ORF | 1209 |
Synonyms | C2orf12; HCC-4; MSSP; MSSP-1; MSSP-2; MSSP-3; SCR2; YC1 |
Summary | This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413821 | RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413822 | RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419042 | RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413821 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 1 |
CNY 3,080.00 |
|
LY413822 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 2 |
CNY 3,080.00 |
|
LY419042 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 3 |
CNY 3,080.00 |
|
PH301015 | RBMS1 MS Standard C13 and N15-labeled recombinant protein (NP_002888) |
CNY 14,250.00 |
|
TP760059 | Recombinant protein of human RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |