United States
Germany
Japan
United Kingdom
China
RBMS1 (NM_002897) Human Mass Spec Standard
CAT＃: PH301015
RBMS1 MS Standard C13 and N15-labeled recombinant protein (NP_002888)
View other "RBMS1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | RBMS1 MS Standard C13 and N15-labeled recombinant protein (NP_002888) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201015 |
| Predicted MW | 44.1 kDa |
| Protein Sequence |
>RC201015 protein sequence
Red=Cloning site Green=Tags(s) MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLP PHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP TNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPP GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTTAAIQNGFYPSPYSIATNRMI TQTSITPYIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTG TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002888 |
| RefSeq Size | 4296 |
| RefSeq ORF | 1209 |
| Synonyms | C2orf12; HCC-4; MSSP; MSSP-1; MSSP-2; MSSP-3; SCR2; YC1 |
| Locus ID | 5937 |
| Cytogenetics | 2q24.2 |
| Summary | This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12. [provided by RefSeq, Feb 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413821 | RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413822 | RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419042 | RBMS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413821 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 1 |
CNY 3,080.00 |
|
| LY413822 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 2 |
CNY 3,080.00 |
|
| LY419042 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 3 |
CNY 3,080.00 |
|
| TP301015 | Recombinant protein of human RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP760059 | Recombinant protein of human RNA binding motif, single stranded interacting protein 1 (RBMS1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
