CLDND1 (NM_019895) Human Recombinant Protein
CAT#: TP301014
Recombinant protein of human claudin domain containing 1 (CLDND1), transcript variant 2, 20 µg
View other "CLDND1" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201014 protein sequence
Red=Cloning site Green=Tags(s) MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFR YNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQ FLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSG EFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_063948 |
Locus ID | 56650 |
UniProt ID | Q9NY35 |
Refseq Size | 2244 |
Cytogenetics | 3q11.2 |
Refseq ORF | 759 |
Synonyms | C3orf4; GENX-3745; Z38 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412679 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421715 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421717 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421724 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421725 | CLDND1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412679 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 2 |
CNY 3,080.00 |
|
LY421715 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 1 |
CNY 3,080.00 |
|
LY421717 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 3 |
CNY 3,080.00 |
|
LY421724 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 6 |
CNY 3,080.00 |
|
LY421725 | Transient overexpression lysate of claudin domain containing 1 (CLDND1), transcript variant 7 |
CNY 3,080.00 |
|
PH301014 | CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948) |
CNY 19,520.00 |