ATG101 (NM_021934) Human Recombinant Protein
CAT#: TP301011
Recombinant protein of human chromosome 12 open reading frame 44 (C12orf44), transcript variant 1, 20 µg
View other "ATG101" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201011 protein sequence
Red=Cloning site Green=Tags(s) MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSE ELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQIC REKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRR LIKDTLAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068753 |
Locus ID | 60673 |
UniProt ID | Q9BSB4 |
Refseq Size | 1458 |
Cytogenetics | 12q13.13 |
Refseq ORF | 654 |
Synonyms | C12orf44 |
Summary | Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411867 | ATG101 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420665 | ATG101 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411867 | Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 1 |
CNY 3,080.00 |
|
LY420665 | Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 2 |
CNY 3,080.00 |
|
PH301011 | C12orf44 MS Standard C13 and N15-labeled recombinant protein (NP_068753) |
CNY 19,520.00 |
|
TP760632 | Purified recombinant protein of Human chromosome 12 open reading frame 44 (C12orf44), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |