ATG101 (NM_021934) Human Mass Spec Standard
CAT#: PH301011
C12orf44 MS Standard C13 and N15-labeled recombinant protein (NP_068753)
View other "ATG101" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C12orf44 MS Standard C13 and N15-labeled recombinant protein (NP_068753) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201011 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC201011 protein sequence
Red=Cloning site Green=Tags(s) MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSE ELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQIC REKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRR LIKDTLAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068753 |
RefSeq Size | 1458 |
RefSeq ORF | 654 |
Synonyms | C12orf44 |
Locus ID | 60673 |
Cytogenetics | 12q13.13 |
Summary | Autophagy factor required for autophagosome formation. Stabilizes ATG13, protecting it from proteasomal degradation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411867 | ATG101 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420665 | ATG101 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411867 | Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 1 |
CNY 3,080.00 |
|
LY420665 | Transient overexpression lysate of chromosome 12 open reading frame 44 (C12orf44), transcript variant 2 |
CNY 3,080.00 |
|
TP301011 | Recombinant protein of human chromosome 12 open reading frame 44 (C12orf44), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760632 | Purified recombinant protein of Human chromosome 12 open reading frame 44 (C12orf44), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |