MSI2 (NM_138962) Human Recombinant Protein
CAT#: TP301003
Recombinant protein of human musashi homolog 2 (Drosophila) (MSI2), transcript variant 1, 20 µg
View other "MSI2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201003 protein sequence
Red=Cloning site Green=Tags(s) MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 35 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620412 |
Locus ID | 124540 |
UniProt ID | Q96DH6 |
Refseq Size | 1581 |
Cytogenetics | 17q22 |
Refseq ORF | 984 |
Synonyms | MSI2H |
Summary | This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells. [provided by RefSeq, Apr 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403371 | MSI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406896 | MSI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403371 | Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 1 |
CNY 3,080.00 |
|
LY406896 | Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 2 |
CNY 3,080.00 |
|
PH301003 | MSI2 MS Standard C13 and N15-labeled recombinant protein (NP_620412) |
CNY 19,520.00 |