MSI2 (NM_138962) Human Mass Spec Standard
CAT#: PH301003
MSI2 MS Standard C13 and N15-labeled recombinant protein (NP_620412)
View other "MSI2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MSI2 MS Standard C13 and N15-labeled recombinant protein (NP_620412) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201003 |
Predicted MW | 35.2 kDa |
Protein Sequence |
>RC201003 protein sequence
Red=Cloning site Green=Tags(s) MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620412 |
RefSeq Size | 1581 |
RefSeq ORF | 984 |
Synonyms | MSI2H |
Locus ID | 124540 |
Cytogenetics | 17q22 |
Summary | This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells. [provided by RefSeq, Apr 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403371 | MSI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406896 | MSI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403371 | Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 1 |
CNY 3,080.00 |
|
LY406896 | Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 2 |
CNY 3,080.00 |
|
TP301003 | Recombinant protein of human musashi homolog 2 (Drosophila) (MSI2), transcript variant 1, 20 µg |
CNY 2,900.00 |