CD71 (TFRC) (NM_003234) Human Recombinant Protein
CAT#: TP300980
Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg
View other "CD71" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200980 representing NM_003234
Red=Cloning site Green=Tags(s) MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 84.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003225 |
Locus ID | 7037 |
UniProt ID | P02786, A8K6Q8, Q7Z3E0 |
Refseq Size | 5010 |
Cytogenetics | 3q29 |
Refseq ORF | 2280 |
Synonyms | CD71; IMD46; p90; T9; TFR; TFR1; TR; TRFR |
Summary | This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protease, Secreted Protein, Transmembrane |
Protein Pathways | Endocytosis, Hematopoietic cell lineage |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Using Quantitative Seroproteomics to Identify Antibody Biomarkers in Pancreatic Cancer
,null,
Cancer immunology research
,PubMed ID 26842750
[TFRC]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418818 | TFRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426898 | TFRC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY418818 | Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) |
CNY 3,080.00 |
|
LY426898 | Transient overexpression lysate of transferrin receptor (p90, CD71) (TFRC) |
CNY 4,840.00 |
|
PH300980 | TFRC MS Standard C13 and N15-labeled recombinant protein (NP_003225) |
CNY 19,520.00 |
|
PH326147 | TFRC MS Standard C13 and N15-labeled recombinant protein (NP_001121620) |
CNY 19,520.00 |
|
TP326147 | Recombinant protein of human transferrin receptor (p90, CD71) (TFRC), 20 µg |
CNY 2,900.00 |