THTPA (NM_024328) Human Recombinant Protein
CAT#: TP300849
Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 1, 20 µg
View other "THTPA" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200849 protein sequence
Red=Cloning site Green=Tags(s) MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL EVNSSRERPQETEDPDHCLG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077304 |
Locus ID | 79178 |
UniProt ID | Q9BU02 |
Refseq Size | 2228 |
Cytogenetics | 14q11.2 |
Refseq ORF | 690 |
Synonyms | THTP; THTPASE |
Summary | This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
Protein Pathways | Metabolic pathways, Thiamine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411308 | THTPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426679 | THTPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411308 | Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 1 |
CNY 3,080.00 |
|
LY426679 | Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 2 |
CNY 3,080.00 |
|
PH300849 | THTPA MS Standard C13 and N15-labeled recombinant protein (NP_077304) |
CNY 19,520.00 |
|
PH325287 | THTPA MS Standard C13 and N15-labeled recombinant protein (NP_001119811) |
CNY 19,520.00 |
|
TP325287 | Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 2, 20 µg |
CNY 2,900.00 |