PLGF (PGF) (NM_002632) Human Recombinant Protein

CAT#: TP300443L

Purified recombinant protein of Human placental growth factor (PGF), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 1 mg

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 36,000.00


货期*
4周

规格
    • 1 mg

Product images

经常一起买 (3)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Anti-Human PlGF-1 Rabbit Polyclonal Antibody
    • 100 ug

CNY 3,150.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200443 representing NM_002632
Red=Cloning site Green=Tags(s)

MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVE
HMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPE
RRRPKGRGKRRREKQRPTDCHLCGDAVPRR

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag Myc-DDK
Predicted MW 19.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002623
Locus ID 5228
UniProt ID P49763
Refseq Size 1758
Cytogenetics 14q24.3
Refseq ORF 510
Synonyms D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760
Summary This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...