PLGF (PGF) (NM_002632) Human Recombinant Protein
CAT#: TP300443
Purified recombinant protein of Human placental growth factor (PGF), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
View other "PLGF" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200443 representing NM_002632
Red=Cloning site Green=Tags(s) MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVE HMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPE RRRPKGRGKRRREKQRPTDCHLCGDAVPRR myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 19.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002623 |
Locus ID | 5228 |
UniProt ID | P49763, Q53XY6, Q86TW6 |
Refseq Size | 1758 |
Cytogenetics | 14q24.3 |
Refseq ORF | 510 |
Synonyms | D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760 |
Summary | This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419203 | PGF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419203 | Transient overexpression lysate of placental growth factor (PGF) |
CNY 3,080.00 |
|
TP333309 | Purified recombinant protein of Homo sapiens placental growth factor (PGF), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg |
CNY 2,900.00 |
|
TP723864 | Purified recombinant protein of Human placental growth factor (PGF / PLGF-1), transcript variant 1 |
CNY 3,820.00 |
|
TP762420 | Purified recombinant protein of Human placental growth factor (PGF), transcript variant 1, Leu19-Arg131, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |