Neuraminidase (NEU1) (NM_000434) Human Recombinant Protein
CAT#: TP300386
Recombinant protein of human sialidase 1 (lysosomal sialidase) (NEU1), 20 µg
View other "Neuraminidase" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 3 publications. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200386 protein sequence
Red=Cloning site Green=Tags(s) MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQ IGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLG AVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREP RKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINAR NQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSF SNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 29118338) |
Reference Data | |
RefSeq | NP_000425 |
Locus ID | 4758 |
UniProt ID | Q99519 |
Refseq Size | 2088 |
Cytogenetics | 6p21.33 |
Refseq ORF | 1245 |
Synonyms | NANH; NEU; SIAL1 |
Summary | The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Lysosome, Other glycan degradation, Sphingolipid metabolism |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Endolysosomal N-glycan processing is critical to attain the most active form of the enzyme acid alpha-glucosidase
,null,
The Journal of Biological Chemistry
,PubMed ID 33971197
[NEU1]
|
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3−/−) mice
,null,
American Journal of Physiology - Lung Cellular and Molecular Physiology
,PubMed ID 31617733
[NEU1]
|
Sialidase inhibitors attenuate pulmonary fibrosis in a mouse model
,Karhadkar, TR;Pilling, D;Cox, N;Gomer, RH;,
Sci Rep
,PubMed ID 29118338
[NEU1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424720 | NEU1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424720 | Transient overexpression lysate of sialidase 1 (lysosomal sialidase) (NEU1) |
CNY 3,080.00 |
|
PH300386 | NEU1 MS Standard C13 and N15-labeled recombinant protein (NP_000425) |
CNY 14,250.00 |
|
TP721041 | Purified recombinant protein of Human sialidase 1 (lysosomal sialidase) (NEU1) |
CNY 1,800.00 |
其它Neuraminidase产品