CLEC4E (NM_014358) Human Recombinant Protein
CAT#: TP300244
Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E), 20 µg
View other "CLEC4E" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200244 protein sequence
Red=Cloning site Green=Tags(s) MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI NPLNKGKSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055173 |
Locus ID | 26253 |
UniProt ID | Q9ULY5 |
Refseq Size | 2158 |
Cytogenetics | 12p13.31 |
Refseq ORF | 657 |
Synonyms | CLECSF9; MINCLE |
Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Fungal engagement of the C-type lectin mincle suppresses dectin-1-induced antifungal immunity
,Wevers, BA;Kaptein, TM;Zijlstra-Willems, EM;Theelen, B;Boekhout, T;Geijtenbeek, TB;Gringhuis, SI;,
Cell Host Microbe 494-505 15 4. April 2014
,PubMed ID 24721577
[CLEC4E]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415339 | CLEC4E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415339 | Transient overexpression lysate of C-type lectin domain family 4, member E (CLEC4E) |
CNY 3,080.00 |
|
PH300244 | CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173) |
CNY 19,520.00 |
|
TP720695 | Purified recombinant protein of Human C-type lectin domain family 4, member E (CLEC4E) |
CNY 3,140.00 |