United States
Germany
Japan
United Kingdom
China
SAE1 (NM_016402) Human Mass Spec Standard
CAT＃: PH327950
SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486)
View other "SAE1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227950 |
| Predicted MW | 38.4 kDa |
| Protein Sequence |
>RC227950 protein sequence
Red=Cloning site Green=Tags(s) MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057486 |
| RefSeq Size | 2538 |
| RefSeq ORF | 1038 |
| Synonyms | AOS1; FLJ3091; HSPC140; SUA1; UBLE1A |
| Locus ID | 10055 |
| Cytogenetics | 19q13.32 |
| Summary | Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401688 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428977 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429497 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401688 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
CNY 3,080.00 |
|
| LY428977 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
CNY 3,080.00 |
|
| LY429497 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
CNY 3,080.00 |
|
| PH301820 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) |
CNY 19,520.00 |
|
| PH326908 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185) |
CNY 14,250.00 |
|
| TP301820 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326908 | Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327950 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg |
CNY 2,900.00 |
