SAE1 (NM_005500) Human Mass Spec Standard
CAT#: PH301820
SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491)
View other "SAE1" proteins (11)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201820 |
Predicted MW | 38.4 kDa |
Protein Sequence |
>RC201820 protein sequence
Red=Cloning site Green=Tags(s) MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005491 |
RefSeq Size | 2538 |
RefSeq ORF | 1038 |
Synonyms | AOS1; HSPC140; SUA1; UBLE1A |
Locus ID | 10055 |
Cytogenetics | 19q13.32 |
Summary | Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401688 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428977 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC429497 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401688 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428977 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY429497 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
CN¥ 3,080.00 |
|
PH326908 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185) |
CN¥ 14,250.00 |
|
PH327950 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) |
CN¥ 19,520.00 |
|
TP301820 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP326908 | Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP327950 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |