CHAC1 (NM_001142776) Human Mass Spec Standard
CAT#: PH327708
CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_001136248)
View other "CHAC1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_001136248) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227708 |
Predicted MW | 23.6 kDa |
Protein Sequence |
>RC227708 representing NM_001142776
Red=Cloning site Green=Tags(s) MGGAQLELPSGARPGVCVRRSFRAHAGDQPRRPPGPIPVPGTMKQESAAPNTPPTSQSPTPSAQFPRNDG DPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQ VQGEQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFC PTEQALALV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001136248 |
RefSeq ORF | 657 |
Locus ID | 79094 |
Cytogenetics | 15q15.1 |
Summary | This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. [provided by RefSeq, Sep 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411345 | CHAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432159 | CHAC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411345 | Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 |
CNY 3,080.00 |
|
LY432159 | Transient overexpression lysate of ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1 |
CNY 3,080.00 |
|
PH300912 | CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_077016) |
CNY 19,520.00 |
|
TP300912 | Recombinant protein of human ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327708 | Purified recombinant protein of Homo sapiens ChaC, cation transport regulator homolog 1 (E. coli) (CHAC1), transcript variant 2, 20 µg |
CNY 2,900.00 |