SPART (NM_001142294) Human Mass Spec Standard
CAT#: PH327155
SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135766)
View other "SPART" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135766) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227155 |
Predicted MW | 72.9 kDa |
Protein Sequence |
>RC227155 protein sequence
Red=Cloning site Green=Tags(s) MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTG WESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAE VNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPP LETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVP DRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI PGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELHEWS EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKV SQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAA KCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQI VDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001135766 |
RefSeq Size | 4838 |
RefSeq ORF | 1998 |
Synonyms | SPG20; TAHCCP1 |
Locus ID | 23111 |
Cytogenetics | 13q13.3 |
Summary | This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. Mutations associated with this gene cause autosomal recessive spastic paraplegia 20 (Troyer syndrome). [provided by RefSeq, Nov 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402406 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428017 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428018 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428019 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402406 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1 |
CNY 3,080.00 |
|
LY428017 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4 |
CNY 4,840.00 |
|
LY428018 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3 |
CNY 4,840.00 |
|
LY428019 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2 |
CNY 4,840.00 |
|
PH307971 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_055902) |
CNY 19,520.00 |
|
PH327162 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135767) |
CNY 14,250.00 |
|
PH327169 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135768) |
CNY 14,250.00 |
|
TP307971 | Recombinant protein of human spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327155 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP327162 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP327169 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2, 20 µg |
CNY 2,900.00 |