SPART (NM_001142296) Human Recombinant Protein
CAT#: TP327169
Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2, 20 µg
View other "SPART" proteins (15)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227169 protein sequence
Red=Cloning site Green=Tags(s) MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTG WESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAE VNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPP LETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVP DRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI PGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELHEWS EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKV SQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAA KCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQI VDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 72.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001135768 |
Locus ID | 23111 |
UniProt ID | Q8N0X7 |
Refseq Size | 5014 |
Cytogenetics | 13q13.3 |
Refseq ORF | 1998 |
Synonyms | SPG20; TAHCCP1 |
Summary | This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. Mutations associated with this gene cause autosomal recessive spastic paraplegia 20 (Troyer syndrome). [provided by RefSeq, Nov 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402406 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428017 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428018 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428019 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402406 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1 |
CNY 3,080.00 |
|
LY428017 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4 |
CNY 4,840.00 |
|
LY428018 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3 |
CNY 4,840.00 |
|
LY428019 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2 |
CNY 4,840.00 |
|
PH307971 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_055902) |
CNY 19,520.00 |
|
PH327155 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135766) |
CNY 14,250.00 |
|
PH327162 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135767) |
CNY 14,250.00 |
|
PH327169 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135768) |
CNY 14,250.00 |
|
TP307971 | Recombinant protein of human spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327155 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP327162 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3, 20 µg |
CNY 2,900.00 |