p53 (TP53) (NM_001126114) Human Mass Spec Standard
CAT#: PH325502
TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119586)
View other "p53" proteins (16)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
CN¥ 1,999.00
CN¥ 2,700.00
CN¥ 3,080.00
Specifications
Product Data | |
Description | TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119586) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225502 |
Predicted MW | 37.6 kDa |
Protein Sequence |
>RC225502 representing NM_001126114
Red=Cloning site Green=Tags(s) MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGR DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQDQTSFQKENC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001119586 |
RefSeq ORF | 1023 |
Synonyms | BCC7; BMFS5; LFS1; P53; TRP53 |
Locus ID | 7157 |
Cytogenetics | 17p13.1 |
Summary | This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Basal cell carcinoma, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, Glioma, Huntington's disease, MAPK signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer, Thyroid cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400186 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426652 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426653 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426654 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400186 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426652 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 2 |
CN¥ 3,080.00 |
|
LY426653 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 4 |
CN¥ 3,080.00 |
|
LY426654 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 3 |
CN¥ 3,080.00 |
|
PH300003 | TP53 MS Standard C13 and N15-labeled recombinant protein (NP_000537) |
CN¥ 19,520.00 |
|
PH325604 | TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119584) |
CN¥ 19,520.00 |
|
TP300003 | Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP325502 | Purified recombinant protein of Homo sapiens tumor protein p53 (TP53), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP325604 | Recombinant protein of human tumor protein p53 (TP53), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP701001 | Purified recombinant protein of human tumor protein P53 (TP53), transcript variant 1, mutant (Y220C), expressed in HEK293 cells, 20ug |
CN¥ 6,650.00 |
|
TP710022 | Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells. |
CN¥ 4,020.00 |
|
TP750119 | Purified recombinant protein of Human tumor protein p53 (TP53), transcript variant 1, full length, N-terminal His and GST tag, expressed in E. coli, 50ug |
CN¥ 2,000.00 |