United States
Germany
Japan
United Kingdom
China
HP1 alpha (CBX5) (NM_001127321) Human Mass Spec Standard
CAT＃: PH325208
CBX5 MS Standard C13 and N15-labeled recombinant protein (NP_001120793)
View other "HP1 alpha" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CBX5 MS Standard C13 and N15-labeled recombinant protein (NP_001120793) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225208 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC225208 protein sequence
Red=Cloning site Green=Tags(s) MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKY KKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLM KWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001120793 |
| RefSeq Size | 11525 |
| RefSeq ORF | 573 |
| Synonyms | HEL25; HP1; HP1A |
| Locus ID | 23468 |
| Cytogenetics | 12q13.13 |
| Summary | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402149 | CBX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426744 | CBX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426745 | CBX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402149 | Transient overexpression lysate of chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 3 |
CNY 3,080.00 |
|
| LY426744 | Transient overexpression lysate of chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 2 |
CNY 3,080.00 |
|
| LY426745 | Transient overexpression lysate of chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 1 |
CNY 3,080.00 |
|
| PH301515 | CBX5 MS Standard C13 and N15-labeled recombinant protein (NP_036249) |
CNY 19,520.00 |
|
| TP301515 | Recombinant protein of human chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP325208 | Recombinant protein of human chromobox homolog 5 (HP1 alpha homolog, Drosophila) (CBX5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP760487 | Purified recombinant protein of Human chromobox homolog 5 (CBX5), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它HP1 alpha产品
