MAGP1 (MFAP2) (NM_001135247) Human Mass Spec Standard
CAT#: PH325196
MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719)
View other "MAGP1" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225196 |
Predicted MW | 20.83 kDa |
Protein Sequence |
>RC225196 representing NM_001135247
Red=Cloning site Green=Tags(s) MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001128719 |
RefSeq ORF | 549 |
Synonyms | MAGP; MAGP-1; MAGP1 |
Locus ID | 4237 |
Cytogenetics | 1p36.13 |
Summary | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400857 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413763 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427608 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400857 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 2 |
CNY 3,080.00 |
|
LY413763 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 1 |
CNY 3,080.00 |
|
LY427608 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 3 |
CNY 3,080.00 |
|
PH302188 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059453) |
CNY 19,520.00 |
|
PH320225 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002394) |
CNY 19,520.00 |
|
TP302188 | Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP320225 | Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP325196 | Purified recombinant protein of Homo sapiens microfibrillar-associated protein 2 (MFAP2), transcript variant 3, 20 µg |
CNY 2,900.00 |