United States
Germany
Japan
United Kingdom
China
MAGP1 (MFAP2) (NM_001135247) Human Recombinant Protein
CAT＃: TP325196
Purified recombinant protein of Homo sapiens microfibrillar-associated protein 2 (MFAP2), transcript variant 3, 20 µg
View other "MAGP1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225196 representing NM_001135247
Red=Cloning site Green=Tags(s) MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001128719 |
| Locus ID | 4237 |
| UniProt ID | P55001 |
| Cytogenetics | 1p36.13 |
| Refseq ORF | 549 |
| Synonyms | MAGP; MAGP-1; MAGP1 |
| Summary | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400857 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413763 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427608 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400857 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 2 |
CNY 3,080.00 |
|
| LY413763 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 1 |
CNY 3,080.00 |
|
| LY427608 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 3 |
CNY 3,080.00 |
|
| PH302188 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059453) |
CNY 19,520.00 |
|
| PH320225 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002394) |
CNY 19,520.00 |
|
| PH325196 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719) |
CNY 14,250.00 |
|
| TP302188 | Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP320225 | Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
