United States
Germany
Japan
United Kingdom
China
ARF1 (NM_001024226) Human Mass Spec Standard
CAT＃: PH324474
ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397)
View other "ARF1" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224474 |
| Predicted MW | 20.7 kDa |
| Protein Sequence |
>RC224474 protein sequence
Red=Cloning site Green=Tags(s) MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001019397 |
| RefSeq Size | 1986 |
| RefSeq ORF | 543 |
| Synonyms | PVNH8 |
| Locus ID | 375 |
| Cytogenetics | 1q42.13 |
| Summary | ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Vibrio cholerae infection |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419819 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422625 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422626 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422627 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425449 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419819 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 4 |
CNY 3,080.00 |
|
| LY422625 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 3 |
CNY 3,080.00 |
|
| LY422626 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 1 |
CNY 3,080.00 |
|
| LY422627 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 2 |
CNY 3,080.00 |
|
| PH301240 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019398) |
CNY 19,520.00 |
|
| PH302141 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001649) |
CNY 19,520.00 |
|
| TP301240 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP302141 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP324474 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 3, 20 µg |
CNY 2,900.00 |
