ARF1 (NM_001024227) Human Mass Spec Standard
CAT#: PH301240
ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019398)
View other "ARF1" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019398) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201240 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC201240 protein sequence
Red=Cloning site Green=Tags(s) MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001019398 |
RefSeq Size | 2020 |
RefSeq ORF | 543 |
Synonyms | PVNH8 |
Locus ID | 375 |
Cytogenetics | 1q42.13 |
Summary | ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419819 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422625 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422626 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422627 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC425449 | ARF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419819 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 4 |
CNY 3,080.00 |
|
LY422625 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 3 |
CNY 3,080.00 |
|
LY422626 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 1 |
CNY 3,080.00 |
|
LY422627 | Transient overexpression lysate of ADP-ribosylation factor 1 (ARF1), transcript variant 2 |
CNY 3,080.00 |
|
PH302141 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001649) |
CNY 19,520.00 |
|
PH324474 | ARF1 MS Standard C13 and N15-labeled recombinant protein (NP_001019397) |
CNY 19,520.00 |
|
TP301240 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP302141 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP324474 | Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 3, 20 µg |
CNY 2,900.00 |