LCE3A (NM_178431) Human Mass Spec Standard
CAT#: PH322176
LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518)
View other "LCE3A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222176 |
Predicted MW | 9 kDa |
Protein Sequence |
>RC222176 representing NM_178431
Red=Cloning site Green=Tags(s) MSCQQNQQQCQPPPKCPAKSPAQCLPPASSSCAPSSGGCGPSSERSCCLSHHRCRRSHRCRCQSSNSCDR GSGQQGGSSSCGHSSAGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_848518 |
RefSeq Size | 270 |
RefSeq ORF | 267 |
Synonyms | LEP13 |
Locus ID | 353142 |
Cytogenetics | 1q21.3 |
Summary | A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405955 | LCE3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405955 | Transient overexpression lysate of late cornified envelope 3A (LCE3A) |
CNY 3,080.00 |
|
TP322176 | Recombinant protein of human late cornified envelope 3A (LCE3A), 20 µg |
CNY 2,900.00 |