LCE3A (NM_178431) Human Recombinant Protein
CAT#: TP322176
Recombinant protein of human late cornified envelope 3A (LCE3A), 20 µg
View other "LCE3A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222176 representing NM_178431
Red=Cloning site Green=Tags(s) MSCQQNQQQCQPPPKCPAKSPAQCLPPASSSCAPSSGGCGPSSERSCCLSHHRCRRSHRCRCQSSNSCDR GSGQQGGSSSCGHSSAGCC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848518 |
Locus ID | 353142 |
UniProt ID | Q5TA76 |
Refseq Size | 270 |
Cytogenetics | 1q21.3 |
Refseq ORF | 267 |
Synonyms | LEP13 |
Summary | A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405955 | LCE3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405955 | Transient overexpression lysate of late cornified envelope 3A (LCE3A) |
CNY 3,080.00 |
|
PH322176 | LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518) |
CNY 19,520.00 |