United States
Germany
Japan
United Kingdom
China
CD44 (NM_000610) Human Mass Spec Standard
CAT＃: PH321771
CD44 MS Standard C13 and N15-labeled recombinant protein (NP_000601)
View other "CD44" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 4,840.00
CNY 1,999.00
CNY 2,700.00
热销推荐Specifications
| Product Data | |
| Description | CD44 MS Standard C13 and N15-labeled recombinant protein (NP_000601) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221771 |
| Predicted MW | 81.54 kDa |
| Protein Sequence |
>RC221771 representing NM_000610
Red=Cloning site Green=Tags(s) MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKAL SIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFD GPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSP WITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNE ENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRN GTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDS HSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTG LVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGY TSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGS QEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLN GEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000601 |
| RefSeq Size | 5748 |
| RefSeq ORF | 2226 |
| Synonyms | CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1 |
| Locus ID | 960 |
| Cytogenetics | 11p13 |
| Summary | The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. [provided by RefSeq, Jul 2008] |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane |
| Protein Pathways | ECM-receptor interaction, Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400203 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424332 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424334 | CD44 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400203 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 1 |
CNY 4,840.00 |
|
| LY424332 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 2 |
CNY 3,080.00 |
|
| LY424334 | Transient overexpression lysate of CD44 molecule (Indian blood group) (CD44), transcript variant 4 |
CNY 3,080.00 |
|
| PH302455 | CD44 MS Standard C13 and N15-labeled recombinant protein (NP_001001389) |
CNY 19,520.00 |
|
| TP302455 | Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP321771 | Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720465 | Recombinant protein of human CD44 molecule (Indian blood group) (CD44), transcript variant 1 |
CNY 3,140.00 |
