Troponin T1 (TNNT1) (NM_003283) Human Mass Spec Standard
CAT#: PH321318
TNNT1 MS Standard C13 and N15-labeled recombinant protein (NP_003274)
View other "Troponin T1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TNNT1 MS Standard C13 and N15-labeled recombinant protein (NP_003274) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221318 |
Predicted MW | 32.8 kDa |
Protein Sequence |
>RC221318 representing NM_003283
Red=Cloning site Green=Tags(s) MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKR MEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEA KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWL PPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003274 |
RefSeq Size | 980 |
RefSeq ORF | 834 |
Synonyms | ANM; NEM5; STNT; TNT; TNTS |
Locus ID | 7138 |
Cytogenetics | 19q13.42 |
Summary | This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418790 | TNNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426666 | TNNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418790 | Transient overexpression lysate of troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 1 |
CNY 3,080.00 |
|
LY426666 | Transient overexpression lysate of troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 3 |
CNY 3,080.00 |
|
TP321318 | Recombinant protein of human troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP710220 | Purified recombinant protein of Human troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它Troponin T1产品