Troponin T1 (TNNT1) (NM_003283) Human Recombinant Protein
CAT#: TP321318
Recombinant protein of human troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 1, 20 µg
View other "Troponin T1" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221318 representing NM_003283
Red=Cloning site Green=Tags(s) MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKR MEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEA KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWL PPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003274 |
Locus ID | 7138 |
UniProt ID | P13805 |
Refseq Size | 980 |
Cytogenetics | 19q13.42 |
Refseq ORF | 834 |
Synonyms | ANM; NEM5; STNT; TNT; TNTS |
Summary | This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418790 | TNNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426666 | TNNT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418790 | Transient overexpression lysate of troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 1 |
CNY 3,080.00 |
|
LY426666 | Transient overexpression lysate of troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 3 |
CNY 3,080.00 |
|
PH321318 | TNNT1 MS Standard C13 and N15-labeled recombinant protein (NP_003274) |
CNY 19,520.00 |
|
TP710220 | Purified recombinant protein of Human troponin T type 1 (skeletal, slow) (TNNT1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
其它Troponin T1产品