United States
Germany
Japan
United Kingdom
China
ENSA (NM_207042) Human Mass Spec Standard
CAT＃: PH320441
ENSA MS Standard C13 and N15-labeled recombinant protein (NP_996925)
View other "ENSA" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ENSA MS Standard C13 and N15-labeled recombinant protein (NP_996925) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220441 |
| Predicted MW | 15.1 kDa |
| Protein Sequence |
>RC220441 representing NM_207042
Red=Cloning site Green=Tags(s) MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGDYKSLHWSV LLCADEMQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_996925 |
| RefSeq Size | 1300 |
| RefSeq ORF | 411 |
| Synonyms | ARPP-19e |
| Locus ID | 2029 |
| Cytogenetics | 1q21.3 |
| Summary | The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404060 | ENSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404105 | ENSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417988 | ENSA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404060 | Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 8 |
CNY 3,080.00 |
|
| LY404105 | Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 1 |
CNY 3,080.00 |
|
| LY417988 | Transient overexpression lysate of endosulfine alpha (ENSA), transcript variant 3 |
CNY 3,080.00 |
|
| PH309655 | ENSA MS Standard C13 and N15-labeled recombinant protein (NP_997051) |
CNY 19,520.00 |
|
| TP309655 | Recombinant protein of human endosulfine alpha (ENSA), transcript variant 8, 20 µg |
CNY 2,900.00 |
|
| TP320441 | Recombinant protein of human endosulfine alpha (ENSA), transcript variant 1, 20 µg |
CNY 2,900.00 |
