FGFR1 (NM_023106) Human Mass Spec Standard
CAT#: PH320009
FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075594)
View other "FGFR1" proteins (22)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075594) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220009 |
Predicted MW | 81.9 kDa |
Protein Sequence |
>RC220009 protein sequence
Red=Cloning site Green=Tags(s) MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKM EKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCI VENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIG PDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTS PLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQVTVSADSSASMNSGV LLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKV AVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGL EYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHI DYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDK PSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSG EDSVFSHEPLPEEPCLPRHPAQLANGGLKRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_075594 |
RefSeq Size | 5644 |
RefSeq ORF | 2193 |
Synonyms | bFGF-R-1; BFGFR; CD331; CEK; ECCL; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD |
Locus ID | 2260 |
Cytogenetics | 8p11.23 |
Summary | The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Adherens junction, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402963 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411517 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC411518 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411519 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC414376 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402963 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 1 |
CNY 3,080.00 |
|
LY411517 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 4 |
CNY 4,840.00 |
|
LY411518 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 5 |
CNY 3,080.00 |
|
LY411519 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 6 |
CNY 3,080.00 |
|
LY414376 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 2 |
CNY 4,840.00 |
|
PH302080 | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075598) |
CNY 19,520.00 |
|
PH312579 | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075595) |
CNY 19,520.00 |
|
PH314979 | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075596) |
CNY 14,250.00 |
|
TP302080 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312579 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP314979 | Purified recombinant protein of Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
TP320009 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP700118 | Purified recombinant protein of Human fibroblast growth factor receptor 1, transcript variant 1, with C-terminal DDK/His tag, expressed in human cells |
CNY 6,650.00 |
|
TP700119 | Purified recombinant protein of human fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome) (FGFR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP700120 | Purified recombinant protein of human fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome) (FGFR1), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710005 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1),residues 1-376 polyhistidine tag, expressed in sf9 cell |
CNY 4,020.00 |
|
TP710236 | Purified recombinant protein of Human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, residues 1-376aa, secretory expressed, with C-terminal HIS tag, expressed in sf9, 20ug |
CNY 4,020.00 |