TIM 1 (HAVCR1) (NM_012206) Human Mass Spec Standard
CAT#: PH317039
HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_036338)
View other "TIM 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_036338) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217039 |
Predicted MW | 39.25 kDa |
Protein Sequence |
>RC217039 representing NM_012206
Red=Cloning site Green=Tags(s) MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVT YRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPT VTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVST FVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQ LFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQA EDNIYIENSLYATD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036338 |
RefSeq Size | 1841 |
RefSeq ORF | 1092 |
Synonyms | CD365; HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1 |
Locus ID | 26762 |
Cytogenetics | 5q33.3 |
Summary | The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 4, 12 and 19. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
miR29b regulates aberrant methylation in In-Vitro diabetic nephropathy model of renal proximal tubular cells
,null,
PLoS ONE
,PubMed ID 30496316
[HAVCR1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415915 | HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420451 | HAVCR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415915 | Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1 |
CNY 3,080.00 |
|
LY420451 | Transient overexpression lysate of hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2 |
CNY 3,080.00 |
|
PH317289 | HAVCR1 MS Standard C13 and N15-labeled recombinant protein (NP_001092884) |
CNY 14,250.00 |
|
TP317039 | Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317289 | Recombinant protein of human hepatitis A virus cellular receptor 1 (HAVCR1), transcript variant 2, 20 µg |
CNY 2,900.00 |