SNX16 (NM_022133) Human Mass Spec Standard
CAT#: PH316565
SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_071416)
View other "SNX16" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_071416) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216565 |
Predicted MW | 39.2 kDa |
Protein Sequence |
>RC216565 protein sequence
Red=Cloning site Green=Tags(s) MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071416 |
RefSeq Size | 3471 |
RefSeq ORF | 1032 |
Locus ID | 64089 |
Cytogenetics | 8q21.13 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The protein encoded by this gene associates with late endosome membranes as is involved in tubule formation, cholesterol transport, and transport of tetraspanin CD81. The encoded protein also inhibits cell migration and tumorigenesis. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403494 | SNX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411753 | SNX16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403494 | Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 2 |
CNY 3,080.00 |
|
LY411753 | Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 1 |
CNY 3,080.00 |
|
PH307476 | SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_690049) |
CNY 19,520.00 |
|
TP307476 | Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP316565 | Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 1, 20 µg |
CNY 2,900.00 |