United States
Germany
Japan
United Kingdom
China
Shugoshin (SGO1) (NM_001012413) Human Mass Spec Standard
CAT＃: PH316188
SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012413)
View other "Shugoshin" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012413) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216188 |
| Predicted MW | 29.3 kDa |
| Protein Sequence |
>RC216188 representing NM_001012413
Red=Cloning site Green=Tags(s) MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ IPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCT ASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKSMKQIQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001012413 |
| RefSeq Size | 1149 |
| RefSeq ORF | 774 |
| Synonyms | CAID; NY-BR-85; SGO; SGOL1 |
| Locus ID | 151648 |
| Cytogenetics | 3p24.3 |
| Summary | The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015] |
| Protein Pathways | Oocyte meiosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408583 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422848 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422849 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422850 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422851 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408583 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C2 |
CNY 3,080.00 |
|
| LY422848 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant A2 |
CNY 4,840.00 |
|
| LY422849 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1 |
CNY 3,080.00 |
|
| LY422850 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B2 |
CNY 3,080.00 |
|
| LY422851 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1 |
CNY 3,080.00 |
|
| PH313965 | SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012411) |
CNY 14,250.00 |
|
| TP313965 | Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1, 20 µg |
CNY 2,900.00 |
|
| TP316188 | Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1, 20 µg |
CNY 2,900.00 |
其它Shugoshin产品
