Histone H2A Bbd (H2AFB1) (NM_001017990) Human Mass Spec Standard
CAT#: PH316020
H2AFB1 MS Standard C13 and N15-labeled recombinant protein (NP_001017990)
View other "Histone H2A Bbd" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | H2AFB1 MS Standard C13 and N15-labeled recombinant protein (NP_001017990) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216020 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC216020 protein sequence
Red=Cloning site Green=Tags(s) MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001017990 |
RefSeq Size | 517 |
RefSeq ORF | 345 |
Synonyms | H2A.B; H2A.Bbd; H2AFB1 |
Locus ID | 474382 |
Cytogenetics | Xq28 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most centromeric copy which is in intron 22 of the F8 gene. [provided by RefSeq, Oct 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422229 | H2AFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY422229 | Transient overexpression lysate of H2A histone family, member B1 (H2AFB1) |
CN¥ 3,080.00 |
|
TP316020 | Recombinant protein of human H2A histone family, member B1 (H2AFB1), 20 µg |
CN¥ 2,900.00 |
其它Histone H2A Bbd产品