Histone H2A Bbd (H2AFB1) (NM_001017990) Human Mass Spec Standard

Specifications

Product Data
Description	H2AFB1 MS Standard C13 and N15-labeled recombinant protein (NP_001017990)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC216020
Predicted MW	12.7 kDa
Protein Sequence	Sequence Link (showhide) >RC216020 protein sequence Red=Cloning site Green=Tags(s) MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_001017990
RefSeq Size	517
RefSeq ORF	345
Synonyms	H2A.B; H2A.Bbd; H2AFB1
Locus ID	474382
Cytogenetics	Xq28
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most centromeric copy which is in intron 22 of the F8 gene. [provided by RefSeq, Oct 2015]
Protein Pathways	Systemic lupus erythematosus

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.