Histone H2A Bbd (H2AFB1) Rabbit Polyclonal Antibody
CAT#: TA332256
Rabbit Polyclonal Anti-H2AFB1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-H2AFB1 Antibody is: synthetic peptide directed towards the N-terminal region of Human H2AFB1. Synthetic peptide located within the following region: SSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 13 kDa |
Gene Name | H2A histone family member B1 |
Database Link | |
Background | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most centromeric copy which is in intron 22 of the F8 gene. |
Synonyms | H2A.Bbd |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Pathways | Systemic lupus erythematosus |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
A novel bisindole-PBD conjugate causes DNA damage induced apoptosis via inhibition of DNA repair pathway
,null,
Cancer Biology & Therapy
,PubMed ID 25010292
[H2AB1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Histone H2A Bbd产品